PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G32460.1
Common NameATM1, ATMYB101, MYB101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 490aa    MW: 54437.2 Da    PI: 5.0911
Description myb domain protein 101
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G32460.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.2e-162067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt Ed +l ++v+++G g+W+++ +  g+ R++k+c++rw ++l
      AT2G32460.1 20 KGPWTTTEDAILTEYVRKHGEGNWNAVQKNSGLLRCGKSCRLRWANHL 67
                     79******************************99**********9986 PP

2Myb_DNA-binding51.91.8e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+++++d++++lG++ W++ a+ ++ gRt++++k++w++
      AT2G32460.1  73 KGSFTPDEEKIIIDLHAKLGNK-WARMASQLP-GRTDNEIKNYWNT 116
                      799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.3541567IPR017930Myb domain
SuperFamilySSF466892.96E-2917114IPR009057Homeodomain-like
SMARTSM007176.4E-141969IPR001005SANT/Myb domain
PfamPF002491.0E-142067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-232174IPR009057Homeodomain-like
CDDcd001671.31E-102267No hitNo description
PROSITE profilePS5129424.97668122IPR017930Myb domain
SMARTSM007179.1E-1672120IPR001005SANT/Myb domain
PfamPF002494.5E-1573116IPR001005SANT/Myb domain
CDDcd001672.14E-1175116No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2575121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009555Biological Processpollen development
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0030154Biological Processcell differentiation
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001017developmental stageM germinated pollen stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MDGGGETTAT ATMEGRGLKK GPWTTTEDAI LTEYVRKHGE GNWNAVQKNS GLLRCGKSCR  60
LRWANHLRPN LKKGSFTPDE EKIIIDLHAK LGNKWARMAS QLPGRTDNEI KNYWNTRMKR  120
RQRAGLPLYP HEIQHQGIDI DDEFEFDLTS FQFQNQDLDH NHQNMIQYTN SSNTSSSSSS  180
FSSSSSQPSK RLRPDPLVST NPGLNPIPDS SMDFQMFSLY NNSLENDNNQ FGFSVPLSSS  240
SSSNEVCNPN HILEYISENS DTRNTNKKDI DAMSYSSLLM GDLEIRSSSF PLGLDNSVLE  300
LPSNQRPTHS FSSSPIIDNG VHLEPPSGNS GLLDALLEES QALSRGGLFK DVRVSSSDLC  360
EVQDKRVKMD FENLLIDHLN SSNHSSLGAN PNIHNKYNEP TMVKVTVDDD DELLTSLLNN  420
FPSTTTPLPD WYRVTEMQNE ASYLAPPSGI LMGNHQGNGR VEPPTVPPSS SVDPMASLGS  480
CYWSNMPSIC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30181215107B-MYB
1mse_C2e-30181212104C-Myb DNA-Binding Domain
1msf_C2e-30181212104C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.282700.0seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible267087_at0.0
Expression AtlasAT2G32460-
AtGenExpressAT2G32460-
ATTED-IIAT2G32460-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. All these results indicate that MYB97, MYB101 and MYB120 participate in pollen tube reception, possibly by controlling the expression of downstream genes.
    [PMID: 24278028]
  2. enhanced expressions of two transcription factors, bHLH30 and MYB101, are able to alter leaf lamina development.
    [PMID: 25268707]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G32460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDabscisic acid, gibberellin
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G32460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2293420.0AK229342.1 Arabidopsis thaliana mRNA for putative MYB family transcription factor, complete cds, clone: RAFL16-59-F24.
GenBankAY5195760.0AY519576.1 Arabidopsis thaliana MYB transcription factor (At2g32460) mRNA, complete cds.
GenBankBT0263810.0BT026381.1 Arabidopsis thaliana At2g32460 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180805.10.0myb domain protein 101
TrEMBLO808830.0O80883_ARATH; At2g32460
STRINGAT2G32460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM51002747
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Gocal GF, et al.
    GAMYB-like genes, flowering, and gibberellin signaling in Arabidopsis.
    Plant Physiol., 2001. 127(4): p. 1682-93
    [PMID:11743113]
  4. Reyes JL,Chua NH
    ABA induction of miR159 controls transcript levels of two MYB factors during Arabidopsis seed germination.
    Plant J., 2007. 49(4): p. 592-606
    [PMID:17217461]
  5. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  6. Kim S, et al.
    Two cap-binding proteins CBP20 and CBP80 are involved in processing primary MicroRNAs.
    Plant Cell Physiol., 2008. 49(11): p. 1634-44
    [PMID:18829588]
  7. Jiang W,Yu D
    Arabidopsis WRKY2 transcription factor mediates seed germination and postgermination arrest of development by abscisic acid.
    BMC Plant Biol., 2009. 9: p. 96
    [PMID:19622176]
  8. Alonso-Peral MM, et al.
    The microRNA159-regulated GAMYB-like genes inhibit growth and promote programmed cell death in Arabidopsis.
    Plant Physiol., 2010. 154(2): p. 757-71
    [PMID:20699403]
  9. Reňák D,Dupl'áková N,Honys D
    Wide-scale screening of T-DNA lines for transcription factor genes affecting male gametophyte development in Arabidopsis.
    Sex. Plant Reprod., 2012. 25(1): p. 39-60
    [PMID:22101548]
  10. Daszkowska-Golec A, et al.
    Arabidopsis suppressor mutant of abh1 shows a new face of the already known players: ABH1 (CBP80) and ABI4-in response to ABA and abiotic stresses during seed germination.
    Plant Mol. Biol., 2013. 81(1-2): p. 189-209
    [PMID:23196831]
  11. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  12. Leydon AR, et al.
    Three MYB transcription factors control pollen tube differentiation required for sperm release.
    Curr. Biol., 2013. 23(13): p. 1209-14
    [PMID:23791732]
  13. Liang Y, et al.
    MYB97, MYB101 and MYB120 function as male factors that control pollen tube-synergid interaction in Arabidopsis thaliana fertilization.
    PLoS Genet., 2013. 9(11): p. e1003933
    [PMID:24278028]
  14. An R, et al.
    The over-expression of two transcription factors, ABS5/bHLH30 and ABS7/MYB101, leads to upwardly curly leaves.
    PLoS ONE, 2014. 9(9): p. e107637
    [PMID:25268707]
  15. Quaedvlieg N, et al.
    Identification of a light-regulated MYB gene from an Arabidopsis transcription factor gene collection.
    Plant Mol. Biol., 1996. 32(5): p. 987-93
    [PMID:8980549]